These structures can be used to show the affect of a frameshift mutation and to examine temperature sensitive mutations.
Read more about the biochemistry of melanin production.
Structures in the collection
| Type | Description | Download structure |
|---|---|---|
| An MW Collection |
 Use the link on the right to download the collection. |
 Siamese_cats.mwc |
| PubChem |
 Tyrosinase converts tyrosine to dopaquinone in the first step of the pathway for synthesizing melanin. |
Tyrosine.sdf.gz |
| PubChem |
 Tyrosinase converts tyrosine to dopaquinone in the first step of the pathway for synthesizing melanin. |
Dopaquinone.sdf.gz |
| PubChem |
 Dopaquinone is converted to melanin in the second step of the pathway for synthesizing melanin. |
Melanin.sdf.gz |
| MMDB |
This tryrosinase structure is from a bacteria, Bacillus megaterium. The sequence is similar to the sequence of the tyrosinase protein in humans and other animals like cats and dogs. |
4P6R-1.cn3 |
| MMDB |
This tryrosinase structure is identical to the other one from Bacillus. Use this for modeling. To show the affect of the delection, copy the sequence below, select it in the structure, and hide the unselected sequences. Do this one row at a time. KYRVRKNVLHLTDTEKRDFVRTVLILKEKGIYDRYIAWHGAAGKFHTPPGSDRNA AHMSSAFLPWHREYLLRFERDLQSINPEVTLPYWEWETDAQMQDPSQSQIWSADF MGGNGNPIKDFIVDTGPFAAGRWTTIDEQGNPSGGLKRNFGATKEAPTLPTRDDVL |
4P6R-2.cn3 |